GLP-1 (1-36) Amide

£185.00 1mg

Proglucagon (72-107) proteolysis product.

GLP-1 (1-36) amide is the posttranslational product of proteolysis of proglucagon (72-107).

Please contact us for availability.

SKU: GH-030 Categories: ,

Additional information

Three Letter Sequence

H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

Molecular Weight

4111.5

Molecular Formula

C184H273N51O57

Sequence

HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store desiccated, frozen and in the dark

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

GLP-1 (1-36) amide, posttranslational, proglucagon (72-107), H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, 99658-04-5, GH-030, GH030