GLP-1 (1-36) amide
£185.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Proglucagon (72-107) proteolysis product.
GLP-1 (1-36) amide is the posttranslational product of proteolysis of proglucagon (72-107).
Please contact us for availability.
Additional information
| Three Letter Sequence | H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
|---|---|
| Molecular Weight | 4111.5 |
| Molecular Formula | C184H273N51O57 |
| Sequence | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | GLP-1 (1-36) amide, posttranslational, proglucagon (72-107), H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, 99658-04-5, GH-030, GH030 |