GIP_HUMAN [22-51]

£175.00 1mg

Endogenous proatherosclerotic peptide hormone.

GIP_HUMAN[22-51] is a potent proatherosclerotic peptide hormone which has a common precursor with glucose-dependent insulinotropic polypeptide (GIP). Chronic infusion of GIP_HUMAN[22-51] into ApoE ??/ ?? mice accelerates the development of aortic atherosclerotic lesions and it also increases the serum concentrations of many inflammatory and proatherogenic proteins, and induces IκB-? degradation and nuclear translocation of NF-κB in human vascular endothelial cells and macrophages. GIP_HUMAN[22-51}] can also be labelled with 5-carboxyfluorescein and stable isotope labelled, please inquire.

SKU: GL-040 Categories: ,

Additional information

Three Letter Sequence

H-Glu-Lys-Lys-Glu-Gly-His-Phe-Ser-Ala-Leu-Pro-Ser-Leu-Pro-Val-Gly-Ser-His-Ala-Lys-Val-Ser-Ser-Pro-Gln-Pro-Arg-Gly-Pro-Arg-OH

Molecular Weight

3181.6

Molecular Formula

C140H226N44O41

Sequence

EKKEGHFSALPSLPVGSHAKVSSPQPRGPR

Solubility

Soluble in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Searchable Words

GIP_HUMAN[22 “51], GL-040, EKKEGHFSALPSLPVGSHAKVSSPQPRGPR, GIP_HUMAN[22-51]