GIP (Human)

£185.00 1mg

Stimulates insulin release.

GIP (Gastric Inhibitory Polypeptide) is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. GIP is released by the K cells of the duodenum and jejunum in response to food intake and while it is weak inhibitor of gastric acid secretion, its main role is to stimulate insulin release. Type 2 diabetics are not responsive to GIP and have lower levels of GIP secretion after a meal when compared to non-diabetics. In mice, absence of GIP receptors correlates with resistance to obesity.

Please contact us for availability.

SKU: GH-150 Categories: ,

Additional information

Other Names

Gastric Inhibitory Polypeptide, Glucose dependent insulinotropic polypeptide

Three Letter Sequence

H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH

Molecular Weight

4983.6

Molecular Formula

C226H338N60O66S

Sequence

YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store dessicated, dark and frozen

Purity

>95% by HPLC

Searchable Words

YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, 100040-31-1, GIP, Gastric Inhibitory Polypeptide, proprotein encoded by the GIP gene, food intake, stimulate insulin release, diabetics , Glucose dependent insulinotropic polypeptide, GH-150, GH150