GIP (Human)
£185.00 1mg
Stimulates insulin release.
GIP (Gastric Inhibitory Polypeptide) is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. GIP is released by the K cells of the duodenum and jejunum in response to food intake and while it is weak inhibitor of gastric acid secretion, its main role is to stimulate insulin release. Type 2 diabetics are not responsive to GIP and have lower levels of GIP secretion after a meal when compared to non-diabetics. In mice, absence of GIP receptors correlates with resistance to obesity.
Please contact us for availability.
Additional information
| Other Names | Gastric Inhibitory Polypeptide, Glucose dependent insulinotropic polypeptide |
|---|---|
| Three Letter Sequence | H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH |
| Molecular Weight | 4983.6 |
| Molecular Formula | C226H338N60O66S |
| Sequence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dessicated, dark and frozen |
| Purity | >95% by HPLC |
| Searchable Words | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, 100040-31-1, GIP, Gastric Inhibitory Polypeptide, proprotein encoded by the GIP gene, food intake, stimulate insulin release, diabetics , Glucose dependent insulinotropic polypeptide, GH-150, GH150 |