GIP (human)
£185.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Stimulates insulin release.
GIP (Gastric Inhibitory Polypeptide) is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. GIP is released by the K cells of the duodenum and jejunum in response to food intake and while it is weak inhibitor of gastric acid secretion, its main role is to stimulate insulin release. Type 2 diabetics are not responsive to GIP and have lower levels of GIP secretion after a meal when compared to non-diabetics. In mice, absence of GIP receptors correlates with resistance to obesity.
Please contact us for availability.
Additional information
| Other Names | Gastric Inhibitory Polypeptide, Glucose dependent insulinotropic polypeptide |
|---|---|
| Three Letter Sequence | H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH |
| Molecular Weight | 4983.6 |
| Molecular Formula | C226H338N60O66S |
| Sequence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dessicated, dark and frozen |
| Purity | >95% by HPLC |
| Searchable Words | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, 100040-31-1, GIP, Gastric Inhibitory Polypeptide, proprotein encoded by the GIP gene, food intake, stimulate insulin release, diabetics , Glucose dependent insulinotropic polypeptide, GH-150, GH150 |