GIP (1-39)
£165.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Endogenous truncated form of GIP.
GIP (1-39) is a highly potent insulinotropic peptide, it is the endogenous truncated form of the incretin hormone GIP (Glucose-dependent Insulinotropic Polypeptide, or Gastric Inhibitory Polypeptide), a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP (1-39) is more potent at stimulating glucose-dependent insulin secretion from rat pancreatic ?-cells than GIP and loss of the incretin effect is an early characteristic of type 2 diabetes.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-OH |
|---|---|
| Molecular Weight | 4633.2 |
| Molecular Formula | C210H316N56O61S |
| Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN |
| Solubility | Soluble to 10 mg per ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dark, dry and frozen |
| Purity | >95% By HPLC |
| Searchable Words | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN, 725474-97-5, GIP (1-39), insulinotropic, endogenous, Glucose-dependent Insulinotropic Polypeptide, Gastric Inhibitory Polypeptide, food intake, diabetes, GH-160, GH160 |