GIP (1-39)

£165.00 1mg

Endogenous truncated form of GIP.

GIP (1-39) is a highly potent insulinotropic peptide, it is the endogenous truncated form of the incretin hormone GIP (Glucose-dependent Insulinotropic Polypeptide, or Gastric Inhibitory Polypeptide), a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP (1-39) is more potent at stimulating glucose-dependent insulin secretion from rat pancreatic ?-cells than GIP and loss of the incretin effect is an early characteristic of type 2 diabetes.

Please contact us for availability.

SKU: GH-160 Categories: ,

Additional information

Three Letter Sequence

H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-OH

Molecular Weight

4633.2

Molecular Formula

C210H316N56O61S

Sequence

YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN

Solubility

Soluble to 10 mg per ml in water

Appearance

Freeze dried solid

Storage

Store dark, dry and frozen

Purity

>95% By HPLC

Searchable Words

YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN, 725474-97-5, GIP (1-39), insulinotropic, endogenous, Glucose-dependent Insulinotropic Polypeptide, Gastric Inhibitory Polypeptide, food intake, diabetes, GH-160, GH160