GIP-1 (3-42) (Human)

£175.00 1mg

Competes with GIP for the receptor binding site.

GIP (3-42) is produced by cleavage of the first two amino acid residues at the N-terminal (Tyr1-Ala2) from GIP (1-42), also known as GIP, by the serine protease dipeptidyl peptidase IV (DPP-IV). GIP (3-42) itself has no biological activity, but it can compete with GIP for the receptor binding site, resulting in GIP receptor (GIPR) inhibition.

SKU: GH-170 Categories: ,

Additional information

Three Letter Sequence

H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH

Molecular Weight

4749.4

Molecular Formula

C214H324N58O63S

Sequence

EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store dessicated and frozen in the dark

Purity

>95% by HPLC

Searchable Words

EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, 1802086-25-4, GIP (3-42), GIP receptor, GIPR, GH-170, GH170