GIP-1 (3-42) (human)
£175.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Competes with GIP for the receptor binding site.
GIP (3-42) is produced by cleavage of the first two amino acid residues at the N-terminal (Tyr1-Ala2) from GIP (1-42), also known as GIP, by the serine protease dipeptidyl peptidase IV (DPP-IV). GIP (3-42) itself has no biological activity, but it can compete with GIP for the receptor binding site, resulting in GIP receptor (GIPR) inhibition.
Additional information
| Three Letter Sequence | H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH |
|---|---|
| Molecular Weight | 4749.4 |
| Molecular Formula | C214H324N58O63S |
| Sequence | EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store dessicated and frozen in the dark |
| Purity | >95% by HPLC |
| Searchable Words | EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, 1802086-25-4, GIP (3-42), GIP receptor, GIPR, GH-170, GH170 |