Galanin (1-29) (Rat, Mouse)
£125.00 1mg
Galanin receptor agonist.
Galanin (1-29) (rat, mouse) is a non-selective galanin receptor agonist, with Ki values of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively. Galanin (1-29) (rat, mouse) is an anticonvulsant which can prevent the occurrence of full kindled seizures in rats. Galanin (1-29) (rat, mouse) causes orexigenic effects in a variety of species.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 |
|---|---|
| Molecular Weight | 3164.48 |
| Molecular Formula | C141H211N43O41 |
| Sequence | GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 |
| Solubility | Soluble to 1 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C-terminal amide |
| Searchable Words | 114547-31-8, GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, Galanin (1-29) (rat, mouse) |