Exendin-4

£125.00 1mg

SKU: GH-001 Categories: ,

Glucagon like peptide 1 (GLP-1) receptor agonist.

Exendin-4, also known as exenatide, is a high affinity glucagon-like peptide 1 (GLP-1) receptor agonist originally isolated from Heloderma suspectum venom. It has 50% amino acid homology to GLP-1 and a longer half-life in vivo, and potentiates glucose-induced insulin secretion in isolated rat islets. Exenatide is used to treat type 2 diabetes mellitus as an add-on treatment and has also been evaluated for the treatment of Parkinson’s disease.

Please contact us for availability.

Additional information

Other Names

Exenatide

Three Letter Sequence

H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-Asn-His-NH2

Molecular Weight

4186.6

Molecular Formula

C184H282N50O60S

Sequence

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Solubility

Soluble in water (10mg/mL), PBS, dilute acid and DMSO.

Appearance

Freeze dried solid

Storage

Store desiccated at -20 °C in the dark

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

Exendin-4, exenatide, glucagon-like peptide 1, GLP-1, Heloderma, suspectum, diabetes mellitus, 141758-74-9, HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-001, GH001