Exendin-4
£125.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Glucagon like peptide 1 (GLP-1) receptor agonist.
Exendin-4, also known as exenatide, is a high affinity glucagon-like peptide 1 (GLP-1) receptor agonist originally isolated from Heloderma suspectum venom. It has 50% amino acid homology to GLP-1 and a longer half-life in vivo, and potentiates glucose-induced insulin secretion in isolated rat islets. Exenatide is used to treat type 2 diabetes mellitus as an add-on treatment and has also been evaluated for the treatment of Parkinson’s disease.
Please contact us for availability.
Additional information
| Other Names | Exenatide |
|---|---|
| Three Letter Sequence | H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-Asn-His-NH2 |
| Molecular Weight | 4186.6 |
| Molecular Formula | C184H282N50O60S |
| Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Solubility | Soluble in water (10mg/mL), PBS, dilute acid and DMSO. |
| Appearance | Freeze dried solid |
| Storage | Store desiccated at -20 °C in the dark |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | Exendin-4, exenatide, glucagon-like peptide 1, GLP-1, Heloderma, suspectum, diabetes mellitus, 141758-74-9, HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-001, GH001 |