Exendin-4 (9-39) Amide

£175.00 1mg

Glucagon like peptide-1 (GLP-1) receptor antagonist.

Exendin-4 (9-39) amide is a potent and selective glucagon-like peptide-1 (GLP-1) receptor antagonist with a Kd of 1.7 nM at cloned human GLP-1 receptors. Exendin-4 (9-39) amide inhibits cAMP production and insulin release caused by GLP-1 (7-36) and exendin-4. Exendin-4 (9-39) amide also blocks the inhibitory effect of GLP-1 on food intake in rats.

Please contact us for availability.

SKU: GH-010 Categories: ,

Additional information

Other Names

Exendin(9-39) amide, Avexitide, 9-39-Exendin 4 (Heloderma suspectum)

Three Letter Sequence

H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Molecular Weight

3369.8 Da

Molecular Formula

C149H234N40O47S

Sequence

DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Solubility

Soluble in dilute acid and physiological buffers

Appearance

Freeze dried solid

Storage

Store desiccated, frozen and in the dark

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

Exendin (9-39) amide, glucagon-like peptide-1, GLP-1 receptor, antagonist, DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, H-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-010, GH010, Avexitide, 9-39-Exendin 4 (Heloderma suspectum)