Exendin-4 (9-39) Amide
£175.00 1mg
Glucagon like peptide-1 (GLP-1) receptor antagonist.
Exendin-4 (9-39) amide is a potent and selective glucagon-like peptide-1 (GLP-1) receptor antagonist with a Kd of 1.7 nM at cloned human GLP-1 receptors. Exendin-4 (9-39) amide inhibits cAMP production and insulin release caused by GLP-1 (7-36) and exendin-4. Exendin-4 (9-39) amide also blocks the inhibitory effect of GLP-1 on food intake in rats.
Please contact us for availability.
Additional information
| Other Names | Exendin(9-39) amide, Avexitide, 9-39-Exendin 4 (Heloderma suspectum) |
|---|---|
| Three Letter Sequence | H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Molecular Weight | 3369.8 Da |
| Molecular Formula | C149H234N40O47S |
| Sequence | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Solubility | Soluble in dilute acid and physiological buffers |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | Exendin (9-39) amide, glucagon-like peptide-1, GLP-1 receptor, antagonist, DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, H-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-010, GH010, Avexitide, 9-39-Exendin 4 (Heloderma suspectum) |