Exendin-4 (9-39) amide
£175.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Glucagon like peptide-1 (GLP-1) receptor antagonist.
Exendin-4 (9-39) amide is a potent and selective glucagon-like peptide-1 (GLP-1) receptor antagonist with a Kd of 1.7 nM at cloned human GLP-1 receptors. Exendin-4 (9-39) amide inhibits cAMP production and insulin release caused by GLP-1 (7-36) and exendin-4. Exendin-4 (9-39) amide also blocks the inhibitory effect of GLP-1 on food intake in rats.
Please contact us for availability.
Additional information
| Other Names | Exendin(9-39) amide, Avexitide, 9-39-Exendin 4 (Heloderma suspectum) |
|---|---|
| Three Letter Sequence | H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
| Molecular Weight | 3369.8 Da |
| Molecular Formula | C149H234N40O47S |
| Sequence | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Solubility | Soluble in dilute acid and physiological buffers |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | Exendin (9-39) amide, glucagon-like peptide-1, GLP-1 receptor, antagonist, DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, H-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-010, GH010, Avexitide, 9-39-Exendin 4 (Heloderma suspectum) |