Exendin-4 (5-39) amide
£195.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Glucagon like peptide 1 (GLP-1) receptor antagonist.
Exendin-4 (5-39) is an antagonist of glucagon-like peptide 1 (GLP-1) receptors. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestinal peptide. Unlike the full length exendin-4, a GLP-1 agonist, exendin (5-39) antagonizes GLP-1 stimulated insulin release after food intake. Exendin (5-39) also modulates synaptic transmission via glutamate uptake in the dentate gyrus and improves memory impairment in ?-amyloid protein-treated rats.
Please contact us for availability.
Additional information
Three Letter Sequence | H-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
---|---|
Molecular Weight | 3806.2 |
Molecular Formula | C169H262N44O54S |
Sequence | TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
Solubility | Soluble in dilute acid |
Appearance | Freeze dried solid |
Storage | Store desiccated, frozen and in the dark |
Purity | >95% by HPLC |
Modifications | C terminal amide |
Searchable Words | Exendin-4 (5-39), antagonist of glucagon-like peptide 1, GLP-1, H-TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-009, GH009 |