Exendin-4 (5-39) Amide

£195.00 1mg

Glucagon like peptide 1 (GLP-1) receptor antagonist.

Exendin-4 (5-39) is an antagonist of glucagon-like peptide 1 (GLP-1) receptors. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestinal peptide. Unlike the full length exendin-4, a GLP-1 agonist, exendin (5-39) antagonizes GLP-1 stimulated insulin release after food intake. Exendin (5-39) also modulates synaptic transmission via glutamate uptake in the dentate gyrus and improves memory impairment in ?-amyloid protein-treated rats.

Please contact us for availability.

SKU: GH-009 Categories: ,

Additional information

Three Letter Sequence

H-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Molecular Weight

3806.2

Molecular Formula

C169H262N44O54S

Sequence

TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store desiccated, frozen and in the dark

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

Exendin-4 (5-39), antagonist of glucagon-like peptide 1, GLP-1, H-TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-009, GH009