Exendin-4 (5-39) Amide
£195.00 1mg
Glucagon like peptide 1 (GLP-1) receptor antagonist.
Exendin-4 (5-39) is an antagonist of glucagon-like peptide 1 (GLP-1) receptors. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestinal peptide. Unlike the full length exendin-4, a GLP-1 agonist, exendin (5-39) antagonizes GLP-1 stimulated insulin release after food intake. Exendin (5-39) also modulates synaptic transmission via glutamate uptake in the dentate gyrus and improves memory impairment in ?-amyloid protein-treated rats.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
|---|---|
| Molecular Weight | 3806.2 |
| Molecular Formula | C169H262N44O54S |
| Sequence | TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Solubility | Soluble in dilute acid |
| Appearance | Freeze dried solid |
| Storage | Store desiccated, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C terminal amide |
| Searchable Words | Exendin-4 (5-39), antagonist of glucagon-like peptide 1, GLP-1, H-TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-009, GH009 |