D1 Peptide
£95.00 1mg
Inhibits IL-13 binding to IL13R2.
D1 is a peptide containing the 81-WKTIITKN-88 conserved sequence from the IL13R?2 binding site, the full sequence being that which interacts directly with IL-13 in site III. IL13R?2 is a cancer/testis-like tumour antigen that is overexpressed in various tumours, and in colorectal cancer, IL13R?2 expression is associated with late stage disease and lower overall survival. D1 blocks IL-13 binding to IL13R2 with near complete inhibition at 50g/ml, and in metastatic colorectal and glioblastoma cancer cells treated with IL-13, D1 peptide inhibits migration, invasion, and proliferation. In vivo, D1 peptide causes a modest increase in survival of mice innoculated with KM12SM colonic cancer cells preincubated with D1, but in contrast, the more stable D1 enantiomer consisting of all D amino acids, D-D1, causes a remarkable increase in survival in animal models, with 40% of mice surviving the experimental endpoint without metastatic lesions in liver. In glioblastoma xenografts, D-D1 peptide administration causes significant growth arrest accompanied by a regression in tumour size. Please contact us for the D-D1 peptide.
Please contact us for availability.
Additional information
Other Names | IL13Rα2 Peptide |
---|---|
Three Letter Sequence | H-Gly-Ser-Glu-Thr-Trp-Lys-Thr-Ile-Ile-Thr-Lys-Asn-OH |
Molecular Weight | 1376.73 |
Molecular Formula | C61H100N16O20 |
Sequence | GSETWKTIITKN |
Solubility | Soluble in water |
Appearance | Freeze dried solid |
Storage | Store dry, frozen and in the dark |
Purity | >95% by HPLC |
Searchable Words | H-CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, Cys-LL 37, host defence peptide, LL 37, N-terminal cysteine, Am-180, AM180 |