Cys-LL37
£225.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
The host defence peptide LL 37 with an additional N-terminal cysteine.
Cys-LL 37 is the host defence peptide LL 37 with an additional N-terminal cysteine attached. This allows immobilization of LL 37 as a novel approach towards endowing material surfaces with bactericidal properties.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
|---|---|
| Molecular Weight | 4596.5 |
| Molecular Formula | C208H345N61O54S1 |
| Sequence | CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store cold, dark and desiccated |
| Purity | >95% by HPLC |
| Searchable Words | H-CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, Cys-LL 37, host defence peptide, LL 37, N-terminal cysteine, Am-180, AM180 |