Cys-LL37

£225.00 1mg

The host defence peptide LL 37 with an additional N-terminal cysteine.

Cys-LL 37 is the host defence peptide LL 37 with an additional N-terminal cysteine attached. This allows immobilization of LL 37 as a novel approach towards endowing material surfaces with bactericidal properties.

Please contact us for availability.

SKU: AM-180 Categories: ,

Additional information

Three Letter Sequence

H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Molecular Weight

4596.5

Molecular Formula

C208H345N61O54S1

Sequence

CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Solubility

Soluble in water

Appearance

Freeze dried solid

Storage

Store cold, dark and desiccated

Purity

>95% by HPLC

Searchable Words

H-CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, Cys-LL 37, host defence peptide, LL 37, N-terminal cysteine, Am-180, AM180