Cys-LL37
£225.00 1mg
The host defence peptide LL 37 with an additional N-terminal cysteine.
Cys-LL 37 is the host defence peptide LL 37 with an additional N-terminal cysteine attached. This allows immobilization of LL 37 as a novel approach towards endowing material surfaces with bactericidal properties.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-Cys-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
|---|---|
| Molecular Weight | 4596.5 |
| Molecular Formula | C208H345N61O54S1 |
| Sequence | CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Solubility | Soluble in water |
| Appearance | Freeze dried solid |
| Storage | Store cold, dark and desiccated |
| Purity | >95% by HPLC |
| Searchable Words | H-CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH, CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, Cys-LL 37, host defence peptide, LL 37, N-terminal cysteine, Am-180, AM180 |