CRF (human, rat)
£175.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Endogenous CRF receptor agonist.
CRF (human, rat) is an endogenous peptide derived from a 196-amino acid preprohormone which acts as an agonist for CRF receptors, with Ki values of 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively. CRF (human, rat) is a major regulator of the hypothalamic pituitary adrenal axis response and is a stress-related neuropeptide whose dysregulation has been associated with depression. Increased CRF (human, rat) production is also associated with Alzheimer’s disease.
Please contact us for availability.
Additional information
Other Names | Corticotropin releasing factor (human, rat), Corticotropin releasing hormone, CRH |
---|---|
Three Letter Sequence | H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 |
Molecular Weight | 4757.51 |
Molecular Formula | C208H344N60O63S2 |
Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 |
Solubility | Soluble to 1.10 mg/ml in water |
Appearance | Freeze dried solid |
Storage | Store dry, frozen and in the dark |
Purity | >95% by HPLC |
Modifications | C-terminal amide |
Searchable Words | CRF (human, rat), CR-020, CR020, Corticotropin Releasing Factor (human, rat), SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, 86784-80-7 |