CRF (Human, Rat)
£175.00 1mg
Endogenous CRF receptor agonist.
CRF (human, rat) is an endogenous peptide derived from a 196-amino acid preprohormone which acts as an agonist for CRF receptors, with Ki values of 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively. CRF (human, rat) is a major regulator of the hypothalamic pituitary adrenal axis response and is a stress-related neuropeptide whose dysregulation has been associated with depression. Increased CRF (human, rat) production is also associated with Alzheimer’s disease.
Please contact us for availability.
Additional information
| Other Names | Corticotropin releasing factor (human, rat), Corticotropin releasing hormone, CRH |
|---|---|
| Three Letter Sequence | H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 |
| Molecular Weight | 4757.51 |
| Molecular Formula | C208H344N60O63S2 |
| Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 |
| Solubility | Soluble to 1.10 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C-terminal amide |
| Searchable Words | CRF (human, rat), CR-020, CR020, Corticotropin Releasing Factor (human, rat), SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, 86784-80-7 |