CRF (Human, Rat)

£175.00 1mg

Endogenous CRF receptor agonist.

CRF (human, rat) is an endogenous peptide derived from a 196-amino acid preprohormone which acts as an agonist for CRF receptors, with Ki values of 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively. CRF (human, rat) is a major regulator of the hypothalamic pituitary adrenal axis response and is a stress-related neuropeptide whose dysregulation has been associated with depression. Increased CRF (human, rat) production is also associated with Alzheimer’s disease.

Please contact us for availability.

SKU: CR-020 Categories: ,

Additional information

Other Names

Corticotropin releasing factor (human, rat), Corticotropin releasing hormone, CRH

Three Letter Sequence

H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2

Molecular Weight

4757.51

Molecular Formula

C208H344N60O63S2

Sequence

SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Solubility

Soluble to 1.10 mg/ml in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Modifications

C-terminal amide

Searchable Words

CRF (human, rat), CR-020, CR020, Corticotropin Releasing Factor (human, rat), SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2, 86784-80-7