Cecropin A

£185.00 1mg

Broad spectrum insect antimicrobial.

Cecropin A (CeA) is a natural linear cationic ?-helical antimicrobial peptide (AMP) originally identified in moths (Hyalophora cecropia) and later in pig intestine. Cecropin A contains a strongly cationic region at its N-terminus and a large hydrophobic tail at its C-terminus, which allow its interaction with the microbial membrane, and then cell lysis by pore formation. Cecropin A has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens. Cecropins constitute a main part of the innate immune system of insects.

Please contact us for availability.

SKU: AM-080 Categories: ,

Additional information

Other Names

CeA

Three Letter Sequence

H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2

Molecular Weight

4003.8

Molecular Formula

C184H313N53O46

Sequence

KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

Solubility

Soluble in dilute acid

Appearance

Freeze dried solid

Storage

Store desiccated, frozen and in the dark

Purity

>95% by HPLC

Modifications

C terminal amide

Searchable Words

H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, 80451-04-3, Cecropin A, CeA), antimicrobial peptide, AMP, moths, Hyalophora cecropia, AM-080, AM080