Cecropin A
£185.00 1mg
Broad spectrum insect antimicrobial.
Cecropin A (CeA) is a natural linear cationic ?-helical antimicrobial peptide (AMP) originally identified in moths (Hyalophora cecropia) and later in pig intestine. Cecropin A contains a strongly cationic region at its N-terminus and a large hydrophobic tail at its C-terminus, which allow its interaction with the microbial membrane, and then cell lysis by pore formation. Cecropin A has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens. Cecropins constitute a main part of the innate immune system of insects.
Please contact us for availability.
Additional information
Other Names | CeA |
---|---|
Three Letter Sequence | H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 |
Molecular Weight | 4003.8 |
Molecular Formula | C184H313N53O46 |
Sequence | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 |
Solubility | Soluble in dilute acid |
Appearance | Freeze dried solid |
Storage | Store desiccated, frozen and in the dark |
Purity | >95% by HPLC |
Modifications | C terminal amide |
Searchable Words | H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, 80451-04-3, Cecropin A, CeA), antimicrobial peptide, AMP, moths, Hyalophora cecropia, AM-080, AM080 |