Cecropin A
£185.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Broad spectrum insect antimicrobial.
Cecropin A (CeA) is a natural linear cationic ?-helical antimicrobial peptide (AMP) originally identified in moths (Hyalophora cecropia) and later in pig intestine. Cecropin A contains a strongly cationic region at its N-terminus and a large hydrophobic tail at its C-terminus, which allow its interaction with the microbial membrane, and then cell lysis by pore formation. Cecropin A has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens. Cecropins constitute a main part of the innate immune system of insects.
Please contact us for availability.
Additional information
Other Names | CeA |
---|---|
Three Letter Sequence | H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 |
Molecular Weight | 4003.8 |
Molecular Formula | C184H313N53O46 |
Sequence | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 |
Solubility | Soluble in dilute acid |
Appearance | Freeze dried solid |
Storage | Store desiccated, frozen and in the dark |
Purity | >95% by HPLC |
Modifications | C terminal amide |
Searchable Words | H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, 80451-04-3, Cecropin A, CeA), antimicrobial peptide, AMP, moths, Hyalophora cecropia, AM-080, AM080 |