Bay 55-9837

£175.00 1mg

Selective VPAC2 agonist.

Bay 55-9837 is a selective vasoactive intestinal peptide receptor 2 (VPAC2 receptor) agonist, binding to VPAC2 with a Kd of 0.65 nmol/l and having greater than 100-fold selectivity over VPAC1. BAY 55-9837 stimulates glucose-dependent insulin secretion in isolated pancreatic islets, increases insulin synthesis in rat islets, and causes a dose-dependent increase in plasma insulin levels in fasted rats. BAY 55-9837 raises survival motor neuron (SMN) protein levels through pharmacological modulation of the SMN2 gene and ameliorates disease phenotype in severe spinal muscular atrophy mouse models.

Please contact us for availability.

SKU: VP-020 Categories: ,

Additional information

Three Letter Sequence

H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2

Molecular Weight

3742.29

Molecular Formula

C167H270N52O46

Sequence

HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2

Solubility

Soluble to 2 mg/ml in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Modifications

C-terminal amide

Searchable Words

Bay 55-9837, 463930-25-8, HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2, VP-020