Bay 55-9837
£175.00 1mg
Selective VPAC2 agonist.
Bay 55-9837 is a selective vasoactive intestinal peptide receptor 2 (VPAC2 receptor) agonist, binding to VPAC2 with a Kd of 0.65 nmol/l and having greater than 100-fold selectivity over VPAC1. BAY 55-9837 stimulates glucose-dependent insulin secretion in isolated pancreatic islets, increases insulin synthesis in rat islets, and causes a dose-dependent increase in plasma insulin levels in fasted rats. BAY 55-9837 raises survival motor neuron (SMN) protein levels through pharmacological modulation of the SMN2 gene and ameliorates disease phenotype in severe spinal muscular atrophy mouse models.
Please contact us for availability.
Additional information
| Three Letter Sequence | H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2 |
|---|---|
| Molecular Weight | 3742.29 |
| Molecular Formula | C167H270N52O46 |
| Sequence | HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2 |
| Solubility | Soluble to 2 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Modifications | C-terminal amide |
| Searchable Words | Bay 55-9837, 463930-25-8, HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2, VP-020 |