Apelin 36 (Human)

£195.00 1mg

Endogenous apelin agonist.

Apelin-36 (human) is an endogenous apelin receptor agonist that is secreted by adipocytes. Apelin-36 (human) binds with high affinity to human apelin receptors expressed in HEK 293 cells (pIC50= 8.61) and is linked to two major types of biological activity: cardiovascular, such as stimulation of cardiac contractility and suppression of blood pressure, and metabolic, including improving glucose homeostasis and lowering body weight, and regulation of cardiovascular function, fluid homeostasis and feeding.

SKU: AR-010 Categories: ,

Additional information

Three Letter Sequence

H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH

Molecular Weight

4195.87

Molecular Formula

C184H297N69O43S

Sequence

LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Solubility

Soluble to 1 mg/ml in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Searchable Words

Apelin-36 (human), Apelin36 (human), 252642-12-9, LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF