Apelin 36 (human)
£195.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Endogenous apelin agonist.
Apelin-36 (human) is an endogenous apelin receptor agonist that is secreted by adipocytes. Apelin-36 (human) binds with high affinity to human apelin receptors expressed in HEK 293 cells (pIC50= 8.61) and is linked to two major types of biological activity: cardiovascular, such as stimulation of cardiac contractility and suppression of blood pressure, and metabolic, including improving glucose homeostasis and lowering body weight, and regulation of cardiovascular function, fluid homeostasis and feeding.
Additional information
| Three Letter Sequence | H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH |
|---|---|
| Molecular Weight | 4195.87 |
| Molecular Formula | C184H297N69O43S |
| Sequence | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
| Solubility | Soluble to 1 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | Apelin-36 (human), Apelin36 (human), 252642-12-9, LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |