ACTH (1-39) (Human)

£175.00 1mg

Endogenous melanocortin receptor 2 (MC2R) agonist.

ACTH (1-39) (human) is a melanocortin receptor 2 (MC2R) agonist with an EC50 of 57 pM. ACTH (1-39) (human), also known as corticotropin, is a cleavage product from the precursor proopiomelanocortin (POMC) and is a peptide hormone produced in the anterior pituitary gland upon stimulation by corticotropin releasing hormone from the hypothalamus, often in response to stress. ACTH (1-39) (human) is used to treat multiple sclerosis relapses, acting by stimulating adrenal corticosteroid production through the MC2R.

Please contact us for availability.

SKU: MC-020 Categories: ,

Additional information

Other Names

Adrenocorticotropic hormone, Corticotropin

Three Letter Sequence

H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH

Molecular Weight

4541.1

Molecular Formula

C207H308N56O58S

Sequence

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

Solubility

Soluble to 1 mg/ml in water

Appearance

Freeze dried solid

Storage

Store dry, frozen and in the dark

Purity

>95% by HPLC

Searchable Words

ACTH (1-39) (human), Adrenocorticotropic hormone (1-39), Corticotropin, 12279-41-3, SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF