ACTH (1-39) (Human)
£175.00 1mg
Endogenous melanocortin receptor 2 (MC2R) agonist.
ACTH (1-39) (human) is a melanocortin receptor 2 (MC2R) agonist with an EC50 of 57 pM. ACTH (1-39) (human), also known as corticotropin, is a cleavage product from the precursor proopiomelanocortin (POMC) and is a peptide hormone produced in the anterior pituitary gland upon stimulation by corticotropin releasing hormone from the hypothalamus, often in response to stress. ACTH (1-39) (human) is used to treat multiple sclerosis relapses, acting by stimulating adrenal corticosteroid production through the MC2R.
Please contact us for availability.
Additional information
| Other Names | Adrenocorticotropic hormone, Corticotropin |
|---|---|
| Three Letter Sequence | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH |
| Molecular Weight | 4541.1 |
| Molecular Formula | C207H308N56O58S |
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Solubility | Soluble to 1 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | ACTH (1-39) (human), Adrenocorticotropic hormone (1-39), Corticotropin, 12279-41-3, SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |