ACTH (1-39) (human)
£175.00 1mg
Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.
Endogenous melanocortin receptor 2 (MC2R) agonist.
ACTH (1-39) (human) is a melanocortin receptor 2 (MC2R) agonist with an EC50 of 57 pM. ACTH (1-39) (human), also known as corticotropin, is a cleavage product from the precursor proopiomelanocortin (POMC) and is a peptide hormone produced in the anterior pituitary gland upon stimulation by corticotropin releasing hormone from the hypothalamus, often in response to stress. ACTH (1-39) (human) is used to treat multiple sclerosis relapses, acting by stimulating adrenal corticosteroid production through the MC2R.
Please contact us for availability.
Additional information
| Other Names | Adrenocorticotropic hormone, Corticotropin |
|---|---|
| Three Letter Sequence | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH |
| Molecular Weight | 4541.1 |
| Molecular Formula | C207H308N56O58S |
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Solubility | Soluble to 1 mg/ml in water |
| Appearance | Freeze dried solid |
| Storage | Store dry, frozen and in the dark |
| Purity | >95% by HPLC |
| Searchable Words | ACTH (1-39) (human), Adrenocorticotropic hormone (1-39), Corticotropin, 12279-41-3, SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |